PDB entry 4arx

View 4arx on RCSB PDB site
Description: Lepidoptera-specific toxin Cry1Ac from Bacillus thuringiensis ssp. kurstaki HD-73
Class: toxin
Keywords: toxin, membrane pore-forming toxin, insecticidal protein lepidopteran specificity, receptor binding site
Deposited on 2012-04-27, released 2013-05-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.18552
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pesticidal crystal protein cry1ac
    Species: Bacillus thuringiensis serovar kurstaki [TaxId:29339]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4arxa1, d4arxa2, d4arxa3
  • Chain 'B':
    Compound: pesticidal crystal protein cry1ac
    Species: Bacillus thuringiensis serovar kurstaki [TaxId:29339]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4arxb1, d4arxb2, d4arxb3
  • Chain 'C':
    Compound: pesticidal crystal protein cry1ac
    Species: Bacillus thuringiensis serovar kurstaki [TaxId:29339]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4arxc1, d4arxc2, d4arxc3
  • Chain 'D':
    Compound: pesticidal crystal protein cry1ac
    Species: Bacillus thuringiensis serovar kurstaki [TaxId:29339]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4arxd1, d4arxd2, d4arxd3
  • Heterogens: 13D, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4arxA (A:)
    tgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqriee
    farnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfav
    qnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrw
    yntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytn
    pvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsg
    peftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefay
    gtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiira
    pmfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqn
    rgyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdf
    gyfesanaftsslgnivgvrnfsgtagviidrfefipvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4arxB (B:)
    tgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqriee
    farnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfav
    qnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrw
    yntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytn
    pvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsg
    peftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefay
    gtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiira
    pmfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqn
    rgyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdf
    gyfesanaftsslgnivgvrnfsgtagviidrfefipvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4arxB (B:)
    gytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieef
    arnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavq
    nyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwy
    ntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytnp
    vlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsgp
    eftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefayg
    tssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiirap
    mfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnr
    gyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfg
    yfesanaftsslgnivgvrnfsgtagviidrfefipvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4arxC (C:)
    tgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqriee
    farnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfav
    qnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrw
    yntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytn
    pvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsg
    peftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefay
    gtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiira
    pmfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqn
    rgyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdf
    gyfesanaftsslgnivgvrnfsgtagviidrfefipvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4arxC (C:)
    gytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieef
    arnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavq
    nyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwy
    ntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytnp
    vlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsgp
    eftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefayg
    tssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiirap
    mfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnr
    gyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfg
    yfesanaftsslgnivgvrnfsgtagviidrfefipvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4arxD (D:)
    tgytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqriee
    farnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfav
    qnyqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrw
    yntglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytn
    pvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsg
    peftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefay
    gtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiira
    pmfswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqn
    rgyievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdf
    gyfesanaftsslgnivgvrnfsgtagviidrfefipvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4arxD (D:)
    ytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieefa
    rnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaiplfavqn
    yqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwyn
    tglervwgpdsrdwvrynqfrreltltvldivalfpnydsrrypirtvsqltreiytnpv
    lenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyywsghqimaspvgfsgpe
    ftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfniginnqqlsvldgtefaygt
    ssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsmfrsgfsnssvsiirapm
    fswihrsaefnniiasdsitqipavkgnflfngsvisgpgftggdlvrlnssgnniqnrg
    yievpihfpststryrvrvryasvtpihlnvnwgnssifsntvpatatsldnlqssdfgy
    fesanaftsslgnivgvrnfsgtagviidrfefipvt