PDB entry 4ar4

View 4ar4 on RCSB PDB site
Description: Neutron crystallographic structure of the reduced form perdeuterated Pyrococcus furiosus rubredoxin to 1.38 Angstrom resolution.
Class: electron transport
Keywords: electron transport, perdeuterated, monochromatic neutron crystallography, hydronium, protonation state
Deposited on 2012-04-20, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: NEUT
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ar4a_
  • Heterogens: FE, D8U, D3O, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ar4A (A:)
    makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled