PDB entry 4ar4

View 4ar4 on RCSB PDB site
Description: Neutron crystallographic structure of the reduced form perdeuterated Pyrococcus furiosus rubredoxin to 1.38 Angstoms resolution.
Class: electron transport
Keywords: electron transport, perdeuterated, monochromatic neutron crystallography, hydronium, protonation state
Deposited on 2012-04-20, released 2013-01-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: NEUT
Resolution: 1.38 Å
R-factor: 0.1881
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rubredoxin
  Species: Pyrococcus furiosus [TaxId:2261]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24297 (0-53)
  Domains in SCOPe 2.04: d4ar4a_
• Heterogens: FE, D8U, D3O, DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ar4A (A:)
  makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled