PDB entry 4aq1

View 4aq1 on RCSB PDB site
Description: Structure of the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 in complex with nanobody KB6
Class: structural protein
Keywords: structural protein, s-layer protein, nanobody
Deposited on 2012-04-12, released 2012-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.18565
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sbsb protein
    Species: GEOBACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45664 (Start-889)
      • conflict (469)
      • conflict (781)
      • expression tag (890-891)
  • Chain 'B':
    Compound: nbkb6
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4AQ1
    Domains in SCOPe 2.07: d4aq1b1, d4aq1b2
  • Chain 'C':
    Compound: sbsb protein
    Species: GEOBACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45664 (Start-889)
      • conflict (371)
      • conflict (469)
      • conflict (781)
      • expression tag (890)
  • Chain 'D':
    Compound: nbkb6
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4AQ1
    Domains in SCOPe 2.07: d4aq1d1, d4aq1d2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aq1B (B:)
    qvqlqesggglvqaggslrlscaasgrtssayamgwfrqapgkerefvagisskggstyy
    gasmkgrftisrdnakntvylqmnglapedtavyycaasdkynfdtshagygywgqgtqv
    tvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq1B (B:)
    qvqlqesggglvqaggslrlscaasgrtssayamgwfrqapgkerefvagisskggstyy
    gasmkgrftisrdnakntvylqmnglapedtavyycaasdkynfdtshagygywgqgtqv
    tvss
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4aq1D (D:)
    qvqlqesggglvqaggslrlscaasgrtssayamgwfrqapgkerefvagisskggstyy
    gasmkgrftisrdnakntvylqmnglapedtavyycaasdkynfdtshagygywgqgtqv
    tvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq1D (D:)
    qvqlqesggglvqaggslrlscaasgrtssayamgwfrqapgkerefvagisskggstyy
    gasmkgrftisrdnakntvylqmnglapedtavyycaasdkynfdtshagygywgqgtqv
    tvss