PDB entry 4apu

View 4apu on RCSB PDB site
Description: PR X-Ray structures in agonist conformations reveal two different mechanisms for partial agonism in 11beta-substituted steroids
Class: transcription
Keywords: transcription, asoprisnil, partial agonist
Deposited on 2012-04-06, released 2012-04-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.20788
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4apua_
  • Chain 'B':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4apub_
  • Heterogens: OR8, SO4, A2K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4apuA (A:)
    gshmgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkws
    kslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkess
    fyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyireli
    kaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevi
    aaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apuA (A:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4apuB (B:)
    gshmgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkws
    kslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkess
    fyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyireli
    kaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevi
    aaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apuB (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfhk