PDB entry 4anw

View 4anw on RCSB PDB site
Description: Complexes of PI3Kgamma with isoform selective inhibitors.
Class: transferase
Keywords: transferase
Deposited on 2012-03-22, released 2012-05-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.238
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.04: d4anwa1, d4anwa2, d4anwa3, d4anwa4
  • Heterogens: SO4, O92, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4anwA (A:)
    mllgsseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyam
    hpwvtskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkksl
    mdipesqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldev
    rkeewplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntd
    ltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgka
    palsskasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfn
    adkltsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleai
    iatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwd
    qsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsala
    rfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqv
    iemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalai
    ekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwete
    sldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspte
    ekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflgi
    nkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtg
    mpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqge
    khsaefglvprgsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4anwA (A:)
    sseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmeqdfvlrvcg
    rdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkecdrkfrvkirgidip
    vlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnl
    qiycqllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisilld
    nraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqe
    ivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllq
    lvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylr
    gcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpes
    frvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdm
    lilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgaf
    kdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfh
    idfghiervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmm
    lmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwf