PDB entry 4amk

View 4amk on RCSB PDB site
Description: Fab fragment of antiporphrin antibody 13g10
Class: immune system
Keywords: immune system, 13g10, metalloporphyrin, catalytic antibody, peroxidase
Deposited on 2012-03-12, released 2012-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab13g10, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AMK (Start-216)
  • Chain 'L':
    Compound: fab13g10, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AMK (Start-211)
    Domains in SCOPe 2.07: d4amkl1, d4amkl2
  • Heterogens: GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4amkL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4amkL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlgqpksspsvtlf
    ppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyl
    tltarawerhssyscqvtheghtvekslsra