PDB entry 4am4

View 4am4 on RCSB PDB site
Description: Bacterioferritin from Blastochloris viridis
Class: metal binding protein
Keywords: metal binding protein, ferroxidase centre, iron storage, di iron centre, double-soaked, iron channel, heme binding
Deposited on 2012-03-07, released 2012-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.16595
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM4 (0-158)
    Domains in SCOPe 2.03: d4am4a_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM4 (0-158)
    Domains in SCOPe 2.03: d4am4b_
  • Heterogens: HEM, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4am4A (A:)
mkgdqkvieylnrglrseltavsqywlhyrmledwgykdlakkwraesieemahadkfve
rilfleglpnlqtldplrigqtvkevlesdlaaerearalyqegaayaasvgdfpsknlf
eelmgdeehhidfletqldlvsklglelyaqhhigkldd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4am4B (B:)
mkgdqkvieylnrglrseltavsqywlhyrmledwgykdlakkwraesieemahadkfve
rilfleglpnlqtldplrigqtvkevlesdlaaerearalyqegaayaasvgdfpsknlf
eelmgdeehhidfletqldlvsklglelyaqhhigkldd