PDB entry 4am0

View 4am0 on RCSB PDB site
Description: Structure of Dengue virus strain 4 DIII in complex with Fab 2H12
Class: viral protein
Keywords: viral protein, antibody, neutralisation
Deposited on 2012-03-06, released 2012-06-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: 0.1988
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab 2h12, heavy chain
    Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM0 (0-216)
  • Chain 'B':
    Compound: fab 2h12, light chain
    Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM0 (0-211)
    Domains in SCOPe 2.04: d4am0b1, d4am0b2
  • Chain 'C':
    Compound: fab 2h12, heavy chain
    Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM0 (0-216)
  • Chain 'D':
    Compound: fab 2h12, light chain
    Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM0 (0-211)
    Domains in SCOPe 2.04: d4am0d1, d4am0d2
  • Chain 'E':
    Compound: fab 2h12, heavy chain
    Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM0 (0-216)
  • Chain 'F':
    Compound: fab 2h12, light chain
    Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM0 (0-211)
    Domains in SCOPe 2.04: d4am0f1, d4am0f2
  • Chain 'H':
    Compound: fab 2h12, heavy chain
    Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM0 (0-216)
  • Chain 'L':
    Compound: fab 2h12, light chain
    Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AM0 (0-211)
    Domains in SCOPe 2.04: d4am0l1, d4am0l2
  • Chain 'Q':
    Compound: envelope protein,
    Species: DENGUE VIRUS [TaxId:11070]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4am0q_
  • Chain 'R':
    Compound: envelope protein,
    Species: DENGUE VIRUS [TaxId:11070]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4am0r_
  • Chain 'S':
    Compound: envelope protein,
    Species: DENGUE VIRUS [TaxId:11070]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4am0s_
  • Chain 'T':
    Compound: envelope protein,
    Species: DENGUE VIRUS [TaxId:11070]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4am0t_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4am0B (B:)
    divmtqsqkfmstsvgdrvsitckasqnvrtsvawyqqkpgqspkaliylasnrhtgvpd
    rftgsgsgtdftltisnvqsedladyfclqhwtypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4am0D (D:)
    divmtqsqkfmstsvgdrvsitckasqnvrtsvawyqqkpgqspkaliylasnrhtgvpd
    rftgsgsgtdftltisnvqsedladyfclqhwtypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4am0F (F:)
    divmtqsqkfmstsvgdrvsitckasqnvrtsvawyqqkpgqspkaliylasnrhtgvpd
    rftgsgsgtdftltisnvqsedladyfclqhwtypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4am0L (L:)
    divmtqsqkfmstsvgdrvsitckasqnvrtsvawyqqkpgqspkaliylasnrhtgvpd
    rftgsgsgtdftltisnvqsedladyfclqhwtypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4am0Q (Q:)
    kgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriiss
    tpfaeytnsvtnieleppfgdsyivigvgdsaltlhwfrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4am0Q (Q:)
    tmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnvvgriisstpfaeytn
    svtnieleppfgdsyivigvgdsaltlhwfr
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4am0R (R:)
    kgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriiss
    tpfaeytnsvtnieleppfgdsyivigvgdsaltlhwfrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4am0R (R:)
    tmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpfae
    ytnsvtnieleppfgdsyivigvgdsaltlhwfrkg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4am0S (S:)
    kgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriiss
    tpfaeytnsvtnieleppfgdsyivigvgdsaltlhwfrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4am0S (S:)
    tmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvkvvgriisstpfaeytn
    svtnieleppfgdsyivigvgdsaltlhwfrk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4am0T (T:)
    kgmsytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriiss
    tpfaeytnsvtnieleppfgdsyivigvgdsaltlhwfrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4am0T (T:)
    tmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpfae
    ytnsvtnieleppfgdsyivigvgdsaltlhwfrk