PDB entry 4als

View 4als on RCSB PDB site
Description: X-Ray photoreduction of Polysaccharide monooxigenase CBM33
Class: chitin-binding protein
Keywords: chitin-binding protein, chitin binding protein, chitin degradation, microspectrophotometry, x-ray induced photo reduction
Deposited on 2012-03-05, released 2013-02-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.15825
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitin binding protein
    Species: ENTEROCOCCUS FAECALIS [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4alsa_
  • Heterogens: CU, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4alsA (A:)
    hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde
    qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk
    qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq