PDB entry 4ale

View 4ale on RCSB PDB site
Description: Structure changes of Polysaccharide monooxygenase CBM33A from Enterococcus faecalis by X-ray induced photoreduction.
Class: chitin binding protein
Keywords: chitin binding protein, cbm33, chitin degradation, microspectrophotometry
Deposited on 2012-03-02, released 2013-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.16219
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitin binding protein
    Species: ENTEROCOCCUS FAECALIS [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4alea_
  • Heterogens: CU, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aleA (A:)
    hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde
    qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk
    qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq