PDB entry 4ala

View 4ala on RCSB PDB site
Description: Structure of Dengue virus DIII in complex with Fab 2H12
Class: immune system
Keywords: immune system, antibody, neutralisation
Deposited on 2012-03-02, released 2012-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.1788
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: envelope protein
    Species: Dengue virus 3 [TaxId:11069]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4alac_
  • Chain 'H':
    Compound: fab 2h12 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ALA (0-216)
  • Chain 'L':
    Compound: fab 2h12 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4ALA (0-211)
    Domains in SCOPe 2.07: d4alal1, d4alal2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4alaC (C:)
kgmsyamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlita
npvvtkkeepvnieaeppfgesnivigigdkalkinwyrkg

    Sequence, based on observed residues (ATOM records): (download) 
    >4alaC (C:)
amclntfvlkkevsetqhgtilikveykgedapckipfstrlitanpvvtkkeepvniea
eppfgnivigikalkinw

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4alaL (L:)
divmtqsqkfmstsvgdrvsitckasqnvrtsvawyqqkpgqspkaliylasnrhtgvpd
rftgsgsgtdftltisnvqsedladyfclqhwtypytfgggtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrn