PDB entry 4al8

View 4al8 on RCSB PDB site
Description: Structure of Dengue virus DIII in complex with Fab 2H12
Class: immune system
Keywords: immune system, antibody, neutralisation
Deposited on 2012-03-02, released 2012-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.1713
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: envelope protein
    Species: Dengue virus [TaxId:12637]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4al8c_
  • Chain 'H':
    Compound: fab 2h12 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AL8 (0-End)
  • Chain 'L':
    Compound: fab 2h12 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AL8 (0-212)
    Domains in SCOPe 2.07: d4al8l1, d4al8l2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4al8C (C:)
    kgmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlita
    npivtdkekpvnieaeppfgesyivvgagekalklswfkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4al8C (C:)
    syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi
    vtdkekpvnieaeppfgesyivvgagekalklswfkkg
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4al8L (L:)
    divmtqsqkfmstsvgdrvsitckasqnvrtsvawyqqkpgqspkaliylasnrhtgvpd
    rftgsgsgtdftltisnvqsedladyfclqhwtypytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne