PDB entry 4ak8

View 4ak8 on RCSB PDB site
Description: Structure of F241L mutant of langerin carbohydrate recognition domain.
Class: sugar binding protein
Keywords: sugar binding protein, langerhans cells, dc-sign, hiv, birbeck granules
Deposited on 2012-02-22, released 2013-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.17754
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • engineered mutation (67)
      • variant (104)
    Domains in SCOPe 2.07: d4ak8a_
  • Chain 'B':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • engineered mutation (67)
      • variant (104)
    Domains in SCOPe 2.07: d4ak8b_
  • Chain 'C':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • engineered mutation (67)
      • variant (104)
    Domains in SCOPe 2.07: d4ak8c_
  • Chain 'D':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71 (Start-154)
      • engineered mutation (67)
      • variant (104)
    Domains in SCOPe 2.07: d4ak8d_
  • Heterogens: CA, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ak8A (A:)
    mwshpqfekiegrmqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsv
    tseseqellyktaggliywigltkagmegdwswvddtpfnkvqsarfwipgepnnagnne
    hcgnikapslqawndapcdktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ak8A (A:)
    sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqellyktaggliywigl
    tkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktf
    lfickrpyvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ak8B (B:)
    mwshpqfekiegrmqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsv
    tseseqellyktaggliywigltkagmegdwswvddtpfnkvqsarfwipgepnnagnne
    hcgnikapslqawndapcdktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ak8B (B:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqellyktaggliywigltk
    agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflf
    ickrpyvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ak8C (C:)
    mwshpqfekiegrmqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsv
    tseseqellyktaggliywigltkagmegdwswvddtpfnkvqsarfwipgepnnagnne
    hcgnikapslqawndapcdktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ak8C (C:)
    sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqellyktaggliywigl
    tkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktf
    lfickrpyvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ak8D (D:)
    mwshpqfekiegrmqndilqvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsv
    tseseqellyktaggliywigltkagmegdwswvddtpfnkvqsarfwipgepnnagnne
    hcgnikapslqawndapcdktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ak8D (D:)
    sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqellyktaggliywigl
    tkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktf
    lfickrpyvpsep