PDB entry 4aj2

View 4aj2 on RCSB PDB site
Description: rat LDHA in complex with 5-(2-chlorophenyl)-1H-tetrazole
Class: oxidoreductase/inhibitor
Keywords: oxidoreductase-inhibitor complex, fragment-based lead generated inhibitors
Deposited on 2012-02-15, released 2012-03-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.15969
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4aj2a1, d4aj2a2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4aj2b1, d4aj2b2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4aj2c1, d4aj2c2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4aj2d1, d4aj2d2
  • Heterogens: GOL, 52C, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aj2A (A:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aj2A (A:)
    alkdqlivnllkvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmdl
    qhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnvv
    kyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhplsc
    hgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayeviklk
    gytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisdvvk
    vtltpdeearlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aj2B (B:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aj2B (B:)
    alkdqlivnllkeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
    dlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpl
    schgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayevik
    lkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisdv
    vkvtltpdeearlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4aj2C (C:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aj2C (C:)
    alkdqlivnllkeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
    dlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpl
    schgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayevik
    lkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisdv
    vkvtltpdeearlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4aj2D (D:)
    aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngis
    dvvkvtltpdeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aj2D (D:)
    alkdqlivnllkeevpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
    dlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkyspqckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpl
    schgwvlgehgdssvpvwsgvnvagvslkslnpqlgtdadkeqwkdvhkqvvdsayevik
    lkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcilgqngisdv
    vkvtltpdeearlkksadtlwgiqkelqf