PDB entry 4aj0

View 4aj0 on RCSB PDB site
Description: Crystallographic structure of an amyloidogenic variant, 3rCW, of the germinal line lambda 3
Class: immune system
Keywords: immune system, amyloidosis
Deposited on 2012-02-15, released 2013-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.1765
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: germinal line lambda 3 3rcw variant
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4AJ0 (Start-106)
    Domains in SCOPe 2.07: d4aj0a_
  • Chain 'B':
    Compound: germinal line lambda 3 3rcw variant
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4AJ0 (0-106)
    Domains in SCOPe 2.07: d4aj0b_
  • Chain 'C':
    Compound: germinal line lambda 3 3rcw variant
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4AJ0 (Start-106)
    Domains in SCOPe 2.07: d4aj0c_
  • Chain 'D':
    Compound: germinal line lambda 3 3rcw variant
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4AJ0 (Start-106)
    Domains in SCOPe 2.07: d4aj0d_
  • Heterogens: PG0, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aj0A (A:)
    syeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiper
    fsgsnsgntatltisgtqamdeadyycqaadsstavvfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aj0A (A:)
    yeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiperf
    sgsnsgntatltisgtqamdeadyycqaadsstavvfgggtkltvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aj0B (B:)
    syeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiper
    fsgsnsgntatltisgtqamdeadyycqaadsstavvfgggtkltvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4aj0C (C:)
    syeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiper
    fsgsnsgntatltisgtqamdeadyycqaadsstavvfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aj0C (C:)
    yeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiperf
    sgsnsgntatltisgtqamdeadyycqaadsstavvfgggtkltvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4aj0D (D:)
    syeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiper
    fsgsnsgntatltisgtqamdeadyycqaadsstavvfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aj0D (D:)
    yeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiperf
    sgsnsgntatltisgtqamdeadyycqaadsstavvfgggtkltvl