PDB entry 4aii

View 4aii on RCSB PDB site
Description: Crystal structure of the rat REM2 GTPase - G domain bound to GDP
Class: GTP-binding protein
Keywords: GTP-binding protein, rgk proteins
Deposited on 2012-02-10, released 2012-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.24693
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein REM 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4aiia_
  • Chain 'B':
    Compound: GTP-binding protein REM 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4aiib_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aiiA (A:)
    mhhhhhhggdgvfkvmllgesgvgkstlagtfgglqgdnahemensedtyerrimvdkee
    vtlivydiweqgdaggwlqdhclqtgdaflivfsvtdrrsfskvpetllrlragrphhdl
    pvilvgnksdlarsrevsleegrhlagtlsckhietsaalhhntrelfegavrqirlrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aiiA (A:)
    dgvfkvmllgesgvgkstlagtfgdtyerrimvdkeevtlivyddhclqtgdaflivfsv
    tdrrsfskvpetllrlragrphhdlpvilvgnksdlarsrevsleegrhlagtlsckhie
    tsaalhhntrelfegavrqirlrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aiiB (B:)
    mhhhhhhggdgvfkvmllgesgvgkstlagtfgglqgdnahemensedtyerrimvdkee
    vtlivydiweqgdaggwlqdhclqtgdaflivfsvtdrrsfskvpetllrlragrphhdl
    pvilvgnksdlarsrevsleegrhlagtlsckhietsaalhhntrelfegavrqirlrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aiiB (B:)
    dgvfkvmllgesgvgkstlagtfggedtyerrimvdkeevtlivyddhclqtgdaflivf
    svtdrrsfskvpetllrlragrphhdlpvilvgnksdlarsrevsleegrhlagtlsckh
    ietsaalhhntrelfegavrqirlrr