PDB entry 4aie

View 4aie on RCSB PDB site
Description: Structure of glucan-1,6-alpha-glucosidase from Lactobacillus acidophilus NCFM
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase 13
Deposited on 2012-02-09, released 2012-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.1395
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucan 1,6-alpha-glucosidase
    Species: Lactobacillus acidophilus NCFM [TaxId:272621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4aiea1, d4aiea2
  • Heterogens: MES, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aieA (A:)
    masaswwknavvyqvypksfqdsngdgigdlqgiisrldyleklgidaiwlspvyqspgv
    dngydisdyeaidpqygtmadmdeliskakehhikivmdlvvnhtsdqhkwfveakkgkd
    nqyrdyyiwrdpvdehepndlksafsgsawkydersgqyylhffadqqpdlnwqntelrq
    kiynmmnfwldkgiggfrmdvieligkdpdknirengpmlhpylqemnkatfgkrdvmtv
    getwnatpkiaeeysdpdrhelsmvfqfenqsldqqpgkekwdlkpldlgelkkvlvkwq
    tkidfdhawnslfwenhdiprvisrwgndqeyrvqcakmfaiilhmmhgtpyifngeeig
    mtncpvknidevediesinmynerlaegydeeelihainvkgrdnarrpmqwndeknagf
    sevdpwlsvnpnykdinvenaladpnsifytyqkliklrhenpivvdgdfslvsntqdav
    layyrilndkkwlvvanlsneeqnfvsndqietilsnypernnvqnitlkpyeafiskvi
    elehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aieA (A:)
    aswwknavvyqvypksfqdsngdgigdlqgiisrldyleklgidaiwlspvyqspgvdng
    ydisdyeaidpqygtmadmdeliskakehhikivmdlvvnhtsdqhkwfveakkgkdnqy
    rdyyiwrdpvdehepndlksafsgsawkydersgqyylhffadqqpdlnwqntelrqkiy
    nmmnfwldkgiggfrmdvieligkdpdknirengpmlhpylqemnkatfgkrdvmtvget
    wnatpkiaeeysdpdrhelsmvfqfenqsldqqpgkekwdlkpldlgelkkvlvkwqtki
    dfdhawnslfwenhdiprvisrwgndqeyrvqcakmfaiilhmmhgtpyifngeeigmtn
    cpvknidevediesinmynerlaegydeeelihainvkgrdnarrpmqwndeknagfsev
    dpwlsvnpnykdinvenaladpnsifytyqkliklrhenpivvdgdfslvsntqdavlay
    yrilndkkwlvvanlsneeqnfvsndqietilsnypernnvqnitlkpyeafiskvi