PDB entry 4ai8

View 4ai8 on RCSB PDB site
Description: factor inhibiting hif-1 alpha in complex with daminozide
Class: oxidoreductase
Keywords: oxidoreductase, dioxygenase, metal-binding, helix-loop-helix-beta, dsbh, facial triad, transcription and epigenetic regulation, ankyrin repeat domain, beta-hydroxylation, transcription activator/inhibitor
Deposited on 2012-02-08, released 2012-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.231
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ai8a_
  • Heterogens: SO4, GOL, DZA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ai8A (A:)
    gshmaataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelie
    neepvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkpr
    snreemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkr
    gwgqltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcd
    rqsqvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwy
    kgaptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ai8A (A:)
    sgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlv
    ypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefve
    klqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlllig
    megnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdye
    rfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieypl
    kahqkvaimrniekmlgealgnpqevgpllntmikgryn