PDB entry 4ahc

View 4ahc on RCSB PDB site
Description: Crystal Structure of an Evolved Replicating DNA Polymerase
Class: transferase
Keywords: transferase, b family polymerase, apoenzyme
Deposited on 2012-02-06, released 2012-03-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.20739
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61875 (0-End)
      • engineered mutation (92)
      • engineered mutation (140)
      • engineered mutation (142)
      • engineered mutation (336)
      • engineered mutation (398-399)
      • engineered mutation (406)
      • engineered mutation (545)
    Domains in SCOPe 2.03: d4ahca1, d4ahca2
  • Chain 'B':
    Compound: DNA polymerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61875 (0-End)
      • engineered mutation (92)
      • engineered mutation (140)
      • engineered mutation (142)
      • engineered mutation (336)
      • engineered mutation (398-399)
      • engineered mutation (406)
      • engineered mutation (545)
    Domains in SCOPe 2.03: d4ahcb1, d4ahcb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ahcA (A:)
    mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
    kivrivdvekvekkflgkpitvwklylehpqdqptirekvrehpavvdifeydipfakry
    lidkglipmegeeelkilafaiatlyhegeefgkgpiimisyadeneakvitwknidlpy
    vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
    mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe
    sgenlervakysmedakatyelgkeflpmeiqlsrligqplwdvsrsstgnlvewfllrk
    ayernevapnkpseeeyqrrlresytggfvkepekglwddivyldfialypsiiithnvs
    pdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktkmketqdpiekill
    dyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwkeleekfgfkvlyi
    dtdglhatipggeseeikkkalefvkyinsklpglleleyegfykrgffvtkkryavide
    egkvitrgleivrrdwseiaketqarvletilkhgdveeavrivkeviqklanyeippek
    laiyeqitrplheykaigphvavakklaakgvkikpgmvigyivlrgdgpisnrailaee
    ydpkkhkydaeyyienqvlpavlrilegfgyrkedlryqktrqvgltswlnikks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ahcA (A:)
    mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
    kivrivdvekvekkflgkpitvwklylehpqdqptirekvrehpavvdifeydipfakry
    lidkglipmegeeelkilafaiatlyhegeefgkgpiimisyadeneakvitwknidlpy
    vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
    mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe
    sgenlervakysmedakatyelgkeflpmeiqlsrligqplwdvsrsstgnlvewfllrk
    ayernevapnkpseeeyqrrlresytggfvkepekglwddivyldfialypsiiithnvs
    pdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktkmketqdpiekill
    dyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwkeleekfgfkvlyi
    dtdglhatipggeseeikkkalefvkyinsklpglleleyegfykrgffvtkkryavide
    egkvitrgleiiaketqarvletilkhgdveeavrivkeviqklanyeippeklaiyeig
    phvavakklakkhkydaeyyienqvlpavlrilegfgyrkedlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ahcB (B:)
    mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
    kivrivdvekvekkflgkpitvwklylehpqdqptirekvrehpavvdifeydipfakry
    lidkglipmegeeelkilafaiatlyhegeefgkgpiimisyadeneakvitwknidlpy
    vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
    mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe
    sgenlervakysmedakatyelgkeflpmeiqlsrligqplwdvsrsstgnlvewfllrk
    ayernevapnkpseeeyqrrlresytggfvkepekglwddivyldfialypsiiithnvs
    pdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktkmketqdpiekill
    dyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwkeleekfgfkvlyi
    dtdglhatipggeseeikkkalefvkyinsklpglleleyegfykrgffvtkkryavide
    egkvitrgleivrrdwseiaketqarvletilkhgdveeavrivkeviqklanyeippek
    laiyeqitrplheykaigphvavakklaakgvkikpgmvigyivlrgdgpisnrailaee
    ydpkkhkydaeyyienqvlpavlrilegfgyrkedlryqktrqvgltswlnikks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ahcB (B:)
    mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
    kivrivdvekvekkflgkpitvwklylehpqdqptirekvrehpavvdifeydipfakry
    lidkglipmegeeelkilafaiatlyhegeefgkgpiimisyadeneakvitwknidlpy
    vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
    mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe
    sgenlervakysmedakatyelgkeflpmeiqlsrligqplwdvsrsstgnlvewfllrk
    ayernevapnkpseeeyqrrlresytggfvkepekglwddivyldfialypsiiithnvs
    pdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktkmketqdpiekill
    dyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwkeleekfgfkvlyi
    dtdglhatipggeseeikkkalefvkyinsklpglleleyegfykrgffvtkkryavide
    egkvitrgleidwseiaketqarvletilkhgdveeavrivkeviqklanyeippeklai
    yeqitaigphvavakklaakgvpgmvigyivlrgdgpisnrailaeeydpkkhkydaeyy
    ienqvlpavlrilegfgyrkedl