PDB entry 4af1

View 4af1 on RCSB PDB site
Description: Archeal Release Factor aRF1
Class: hydrolase
Keywords: hydrolase, translation
Deposited on 2012-01-16, released 2013-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.255
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide chain release factor subunit 1
    Species: HALOBACTERIUM SALINARUM [TaxId:478009]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4af1a1, d4af1a2, d4af1a3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4af1A (A:)
    mseqdevpsedrrkyefrkvieelkdyegsgtqlvtiyippdkqisdvvahvtqehseas
    nikskqtrtnvqdaltsikdrlryydtfppdngmvvfsgavdsgggrtdmvtevlesppq
    piesfryhcdsaflteplaemlgdkglyglivldrresnvgwlkgkrvqpvksaeslvpg
    kqrkggqsaqrfarlrleaidnfyqevagmaddlfvpkrheidgilvggpsptkdefldg
    dylhhelqdkvlgkfdvsytdesglsdlvdagqaalaeadlmddksdmeeffeelnggkl
    atygfeqtrrnlimgsvdrllvsedlredvviyecpndheeyetidrrntspehtcsdcg
    eeatevdredaidhlmsiadqrgtethfistdfekgeqlltafggyagilrystgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4af1A (A:)
    vpsedrrkyefrkvieelkdyegsgtqlvtiyippdkqisdvvahvtqehseasnikskq
    trtnvqdaltsikdrlryydtfppdngmvvfsgavdsgggrtdmvtevlesppqpiesfr
    yhcdsaflteplaemlgdkglyglivldrresnvgwlkgkrvqpvksaeslvpgkqrkgg
    qsaqrfarlrleaidnfyqevagmaddlfvpkrheidgilvggpsptkdefldgdylhhe
    lqdkvlgkfdvsytdesglsdlvdagqaalaeadlmddksdmeeffeelnggklatygfe
    qtrrnlimgsvdrllvsedlredvviyecpndheeyetidrrntspehtcsdcgeeatev
    dredaidhlmsiadqrgtethfistdfekgeqlltafggyagilrystgv