PDB entry 4aeh

View 4aeh on RCSB PDB site
Description: Crystal structure of the anti-AaHI Fab9C2 antibody
Class: immune system
Keywords: immune system, androctonus, alpha-toxin, combining site, epitope, pharmacological site, venom, voltage- activated sodium channel, scorpion
Deposited on 2012-01-10, released 2012-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17606
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AEH (0-End)
  • Chain 'L':
    Compound: fab antibody, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4AEH (0-End)
    Domains in SCOPe 2.07: d4aehl1, d4aehl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4aehL (L:)
    dvqmtqspaslsvsvgetvtitcraseniyrnlawyqqkqgkspqllvyaatnlaagvps
    rfsgsgsgtqyslkinslqsedfgsyycqhfwnipftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aehL (L:)
    dvqmtqspaslsvsvgetvtitcraseniyrnlawyqqkqgkspqllvyaatnlaagvps
    rfsgsgsgtqyslkinslqsedfgsyycqhfwnipftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn