PDB entry 4aca

View 4aca on RCSB PDB site
Description: crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
Class: translation
Keywords: selenocysteine, translation, secis element, ef-sec, sec-tRNA(sec)
Deposited on 2011-12-14, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-07, with a file datestamp of 2012-11-02.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.1743
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J307 (14-481)
      • expression tag (13)
    Domains in SCOPe 2.07: d4acaa1, d4acaa2, d4acaa3, d4acaa4, d4acaa5
  • Chain 'B':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4acab1, d4acab2, d4acab3, d4acab4
  • Chain 'C':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J307 (14-481)
      • expression tag (11-13)
    Domains in SCOPe 2.07: d4acac1, d4acac2, d4acac3, d4acac4, d4acac5
  • Chain 'D':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4acad1, d4acad2, d4acad3, d4acad4
  • Heterogens: SO4, DXC, 5GP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4acaA (A:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acaA (A:)
    hmdfkninlgifghidhgkttlskvlteigfsafklenyritlvdapghadliravvsaa
    diidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrtemimksil
    qsthnlknssiipisaktgfgvdelknliittlnnaeiirntesyfkmpldhafpikgag
    tvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvmeakagdrvgmaiqgvdakqi
    yrgciltskdtklqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtf
    gkteeniilnevisgnecycafeleekvlaevgdrvlitrldlppttlricghglieefk
    pikdlnikkevlregkvkidkgrtvidglaqskvaaekligeeisiegkdivgkikgtfg
    tkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4acaB (B:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acaB (B:)
    mdfkninlgifghidhgkttlskvlteiakrgitidigfsafklenyritlvdapghadl
    iravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrt
    emimksilqsthnlknssiipisaktgfgvdelknliittlnnaeiirntesyfkmpldh
    afpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvmeakagdrvgmai
    qgvdakqiyrgciltskdtklqtvdkivakikisdifkynltpkmkvhlnvgmlivpava
    vpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdrvlitrldlppttlricg
    hglieefkpikdlnikkevlregkvkidkgrtvidglaqskvaaekligeeisiegkdiv
    gkikgtfgtkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4acaC (C:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acaC (C:)
    rphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafkle
    nyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivv
    itksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnae
    iirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfke
    svmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikisdifkynltpkm
    kvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdrvl
    itrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvidglaqskvaae
    kligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4acaD (D:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4acaD (D:)
    dfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyri
    tlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitks
    dnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeiirn
    tesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvme
    akagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikisdifkynltpkmkvhl
    nvgmlivpavavpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdrvlitrl
    dlppttlricghglieefkpikdlnikkevlregkvkidkgrtvidglaqskvaaeklig
    eeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrrwg