PDB entry 4ac9

View 4ac9 on RCSB PDB site
Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with GDP
Class: translation
Keywords: selenocysteine, translation, secis element, ef-sec, sec-tRNA(sec)
Deposited on 2011-12-14, released 2012-08-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 3.03 Å
R-factor: 0.1913
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mj0495-like protein
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J307 (14-481)
      • expression tag (13)
    Domains in SCOPe 2.02: d4ac9a1, d4ac9a2, d4ac9a3, d4ac9a4
  • Chain 'B':
    Compound: mj0495-like protein
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4ac9b1, d4ac9b2, d4ac9b3, d4ac9b4
  • Chain 'C':
    Compound: mj0495-like protein
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J307 (14-481)
      • expression tag (11-13)
    Domains in SCOPe 2.02: d4ac9c1, d4ac9c2, d4ac9c3, d4ac9c4
  • Chain 'D':
    Compound: mj0495-like protein
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4ac9d1, d4ac9d2, d4ac9d3, d4ac9d4
  • Heterogens: GDP, MG, SO4, DXC, 5GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ac9A (A:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ac9A (A:)
    hmdfkninlgifghidhgkttlskvlteigfsafklenyritlvdapghadliravvsaa
    diidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrtemimksil
    qsthnlknssiipisaktgfgvdelknliittlnnaeiirntesyfkmpldhafpikgag
    tvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvmeakagdrvgmaiqgvdakqi
    yrgciltskdtklqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtf
    gkteeniilnevisgnecycafeleekvlaevgdrvlitrldlppttlricghglieefk
    pikdlnikkevlregkvkidkgrtvidglaqskvaaekligeeisiegkdivgkikgtfg
    tkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ac9B (B:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ac9B (B:)
    mdfkninlgifghidhgkttlskvlteiakrgitidigfsafklenyritlvdapghadl
    iravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrt
    emimksilqsthnlknssiipisaktgfgvdelknliittlnnaeiirntesyfkmpldh
    afpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvmeakagdrvgmai
    qgvdakqiyrgciltskdtklqtvdkivakikisdifkynltpkmkvhlnvgmlivpava
    vpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdrvlitrldlppttlricg
    hglieefkpikdlnikkevlregkvkidkgrtvidglaqskvaaekligeeisiegkdiv
    gkikgtfgtkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ac9C (C:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ac9C (C:)
    rphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafkle
    nyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivv
    itksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnae
    iirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfke
    svmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikisdifkynltpkm
    kvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdrvl
    itrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvidglaqskvaae
    kligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ac9D (D:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ac9D (D:)
    dfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyri
    tlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitks
    dnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeiirn
    tesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvme
    akagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikisdifkynltpkmkvhl
    nvgmlivpavavpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdrvlitrl
    dlppttlricghglieefkpikdlnikkevlregkvkidkgrtvidglaqskvaaeklig
    eeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrrwg