PDB entry 4aay

View 4aay on RCSB PDB site
Description: Crystal Structure of the arsenite oxidase protein complex from Rhizobium species strain NT-26
Class: oxidoreductase
Keywords: oxidoreductase, rieske, iron sulfur, molybdopterin
Deposited on 2011-12-05, released 2012-12-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.19433
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aroa
    Species: ARSENITE-OXIDISING BACTERIUM NT-26 [TaxId:97708]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: arob
    Species: ARSENITE-OXIDISING BACTERIUM NT-26 [TaxId:97708]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4aayb_
  • Chain 'C':
    Compound: aroa
    Species: ARSENITE-OXIDISING BACTERIUM NT-26 [TaxId:97708]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: arob
    Species: ARSENITE-OXIDISING BACTERIUM NT-26 [TaxId:97708]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4aayd_
  • Chain 'E':
    Compound: aroa
    Species: ARSENITE-OXIDISING BACTERIUM NT-26 [TaxId:97708]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: arob
    Species: ARSENITE-OXIDISING BACTERIUM NT-26 [TaxId:97708]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4aayf_
  • Chain 'G':
    Compound: aroa
    Species: ARSENITE-OXIDISING BACTERIUM NT-26 [TaxId:97708]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: arob
    Species: ARSENITE-OXIDISING BACTERIUM NT-26 [TaxId:97708]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4aayh_
  • Heterogens: MGD, O, 4MO, F3S, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aayB (B:)
    msrcqnmvdigrrqflrggalaaagataavfgvgapqaraataaagveypanrlanisel
    tlnepldvaypdedaagvllklgtrveggvgpdgdivgfsticphkgfplsysadnktfn
    cpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegvdeliygrlsnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aayB (B:)
    aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic
    phkgfplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv
    deliygrlsnvl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4aayD (D:)
    msrcqnmvdigrrqflrggalaaagataavfgvgapqaraataaagveypanrlanisel
    tlnepldvaypdedaagvllklgtrveggvgpdgdivgfsticphkgfplsysadnktfn
    cpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegvdeliygrlsnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aayD (D:)
    aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic
    phkgfplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv
    deliygrlsnvl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4aayF (F:)
    msrcqnmvdigrrqflrggalaaagataavfgvgapqaraataaagveypanrlanisel
    tlnepldvaypdedaagvllklgtrveggvgpdgdivgfsticphkgfplsysadnktfn
    cpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegvdeliygrlsnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aayF (F:)
    aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic
    phkgfplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv
    deliygrlsnvl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4aayH (H:)
    msrcqnmvdigrrqflrggalaaagataavfgvgapqaraataaagveypanrlanisel
    tlnepldvaypdedaagvllklgtrveggvgpdgdivgfsticphkgfplsysadnktfn
    cpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegvdeliygrlsnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aayH (H:)
    aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic
    phkgfplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv
    deliygrlsnvl