PDB entry 4a9y

View 4a9y on RCSB PDB site
Description: p38alpha map kinase bound to cmpd 8
Class: transferase
Keywords: transferase
Deposited on 2011-11-29, released 2012-05-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21961
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4a9ya_
  • Heterogens: AQZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a9yA (A:)
    hhhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkl
    srpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnn
    ivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarht
    ddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkli
    lrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdk
    ritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldq
    eemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a9yA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkltddhv
    qfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfgvatrwyrapeimlnwmh
    ynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyi
    qsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepv
    adpydqsfesrdllidewksltydevisfvpppl