PDB entry 4a7s

View 4a7s on RCSB PDB site
Description: Structure of human I113T SOD1 mutant complexed with 5-Fluorouridine in the p21 space group
Class: oxidoreductase
Keywords: oxidoreductase, amyotrophic lateral sclerosis, antioxidant
Deposited on 2011-11-14, released 2012-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: 0.16394
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (112)
    Domains in SCOPe 2.08: d4a7sa_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (112)
    Domains in SCOPe 2.08: d4a7sf_
  • Heterogens: CU, ZN, SO4, ACT, 5UD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a7sA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhcitgrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a7sF (F:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhcitgrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq