PDB entry 4a73

View 4a73 on RCSB PDB site
Description: single point mutant of thermus thermophilus lactate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, thermophile
Deposited on 2011-11-10, released 2011-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.1727
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (198)
    Domains in SCOPe 2.07: d4a73a1, d4a73a2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (198)
    Domains in SCOPe 2.07: d4a73b1, d4a73b2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (198)
    Domains in SCOPe 2.07: d4a73c1, d4a73c2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (198)
    Domains in SCOPe 2.07: d4a73d1, d4a73d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a73A (A:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a73B (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a73B (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrqlldrnaqvfaqvvprvleaapeavllvatnpvdv
    mtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvws
    saqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvra
    iltdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeil
    keaafalgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a73C (C:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a73C (C:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrllldrnaqvfaqvvprvleaapeavllvatnpvdv
    mtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvws
    saqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvra
    iltdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeil
    keaafalgf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a73D (D:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf