PDB entry 4a6y

View 4a6y on RCSB PDB site
Description: crystal structure of fab fragment of anti-(4-hydroxy-3-nitrophenyl) -acetyl murine germline antibody bbe6.12h3
Class: immune system
Keywords: immune system, antibody multispecificity, humoral immune system, complementarity determining region flexibility
Deposited on 2011-11-10, released 2012-02-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.24
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antibody bbe6.12h3 light chain
  Species: MUS MUSCULUS [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 4A6Y (0-210)
• Chain 'B':
  Compound: antibody bbe6.12h3 heavy chain
  Species: MUS MUSCULUS [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 4A6Y (Start-219)
• Chain 'H':
  Compound: antibody bbe6.12h3 heavy chain
  Species: MUS MUSCULUS [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 4A6Y (0-219)
• Chain 'L':
  Compound: antibody bbe6.12h3 light chain
  Species: MUS MUSCULUS [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 4A6Y (0-210)
  Domains in SCOPe 2.04: d4a6yl1, d4a6yl2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4a6yL (L:)
  qavvtqesalttspgetvtlkcasstgavttsnyanwvqekpdhlftgliggtnnrapgv
  parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
  fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
  ltltarawerhssyscqvtheghtvekslsr