PDB entry 4a6g

View 4a6g on RCSB PDB site
Description: N-acyl amino acid racemase from Amycalotopsis sp. Ts-1-60: G291D- F323Y mutant in complex with N-acetyl methionine
Class: lyase
Keywords: lyase, biocatalysis
Deposited on 2011-11-02, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.15816
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acylamino acid racemase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-367)
      • engineered mutation (290)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d4a6ga1, d4a6ga2
  • Chain 'B':
    Compound: N-acylamino acid racemase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-End)
      • engineered mutation (290)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d4a6gb1, d4a6gb2
  • Chain 'C':
    Compound: N-acylamino acid racemase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-End)
      • engineered mutation (290)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d4a6gc1, d4a6gc2
  • Chain 'D':
    Compound: N-acylamino acid racemase
    Species: AMYCOLATOPSIS SP. [TaxId:37632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44244 (0-End)
      • engineered mutation (290)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d4a6gd1, d4a6gd2
  • Heterogens: AME, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a6gA (A:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a6gB (B:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6gB (B:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwig
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a6gC (C:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6gC (C:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a6gD (D:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a6gD (D:)
    mklsgvelrrvqmplvapfrtsfgtqsvrellllravtpagegwgecvtmagplysseyn
    dgaehvlrhylipallaaeditaakvtpllakfkghrmakgalemavldaelrahersfa
    aelgsvrdsvpcgvsvgimdtipqlldvvggyldegyvriklkiepgwdvepvravrerf
    gddvllqvdantaytlgdapqlarldpfglllieqpleeedvlghaelarriqtpiclde
    sivsaraaadaiklgavqivnikpgrvggylearrvhdvcaahgipvwcgdmietglgra
    anvalaslpnftlpgdtsasdryyktditepfvlsgghlpvptgpglgvapipelldevt
    takvwig