PDB entry 4a5n

View 4a5n on RCSB PDB site
Description: Redoxregulator HypR in its reduced form
Class: transcription
Keywords: transcription, activator, DNA binding, marr-like
Deposited on 2011-10-26, released 2012-01-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.18544
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37486
      • engineered mutation (13)
    Domains in SCOPe 2.04: d4a5na_
  • Chain 'B':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37486
      • engineered mutation (13)
    Domains in SCOPe 2.04: d4a5nb_
  • Chain 'C':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37486
      • engineered mutation (13)
    Domains in SCOPe 2.04: d4a5nc_
  • Chain 'D':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37486
      • engineered mutation (13)
    Domains in SCOPe 2.04: d4a5nd_
  • Heterogens: BME, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a5nA (A:)
    msekkniypnkegspveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5nA (A:)
    gspveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhr
    evyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a5nB (B:)
    msekkniypnkegspveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5nB (B:)
    gspveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhr
    evyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a5nC (C:)
    msekkniypnkegspveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5nC (C:)
    spveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
    vyhqvppkveysltefgrtlepivlqmkewgesnrdvlesy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a5nD (D:)
    msekkniypnkegspveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5nD (D:)
    spveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
    vyhqvppkveysltefgrtlepivlqmkewgesnrdvlesy