PDB entry 4a5m

View 4a5m on RCSB PDB site
Description: Redox regulator HypR in its oxidized form
Class: transcription
Keywords: transcription, activator, DNA-binding
Deposited on 2011-10-26, released 2012-01-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.20965
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a5ma_
  • Chain 'B':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a5mb_
  • Chain 'C':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a5mc_
  • Chain 'D':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a5md_
  • Chain 'E':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a5me_
  • Chain 'F':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a5mf_
  • Chain 'G':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a5mg_
  • Chain 'H':
    Compound: uncharacterized hth-type transcriptional regulator yybr
    Species: BACILLUS SUBTILIS [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a5mh_
  • Heterogens: EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a5mA (A:)
    msekkniypnkegcpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5mA (A:)
    cpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
    vyhqvppkveysltefgrtlepivlqmkewgesnrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a5mB (B:)
    msekkniypnkegcpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5mB (B:)
    cpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
    vyhqvppkveysltefgrtlepivlqmkewgesnrdv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a5mC (C:)
    msekkniypnkegcpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5mC (C:)
    cpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
    vyhqvppkveysltefgrtlepivlqmkewgesnrd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a5mD (D:)
    msekkniypnkegcpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5mD (D:)
    cpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
    vyhqvppkveysltefgrtlepivlqmkewgesnrdv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4a5mE (E:)
    msekkniypnkegcpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5mE (E:)
    cpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
    vyhqvppkveysltefgrtlepivlqmkewgesnrd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4a5mF (F:)
    msekkniypnkegcpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5mF (F:)
    cpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
    vyhqvppkveysltefgrtlepivlqmkewgesnrdv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4a5mG (G:)
    msekkniypnkegcpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5mG (G:)
    cpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
    vyhqvppkveysltefgrtlepivlqmkewgesnrd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4a5mH (H:)
    msekkniypnkegcpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlq
    lreleadgivhrevyhqvppkveysltefgrtlepivlqmkewgesnrdvlesyrsnglv
    kdqqkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a5mH (H:)
    cpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
    vyhqvppkveysltefgrtlepivlqmkewgesnrdv