PDB entry 4a4v

View 4a4v on RCSB PDB site
Description: Ligand binding domain of human PPAR gamma in complex with amorfrutin 2
Class: receptor
Keywords: receptor, agonist, diabetes, insulin resistance
Deposited on 2011-10-20, released 2012-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21146
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a4va_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a4vb_
  • Heterogens: YFD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a4vA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a4vA (A:)
    qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
    skevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlasl
    mnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviil
    sgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqll
    qvikktetdmslhpllqeiykdly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a4vB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a4vB (B:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytm
    laslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifia
    viilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivteh
    vqllqvikktetdmslhpllqeiyk