PDB entry 4a4d

View 4a4d on RCSB PDB site
Description: Crystal structure of the N-terminal domain of the Human DEAD-BOX RNA helicase DDX5 (P68)
Class: hydrolase
Keywords: ATP-binding, hydrolase, RNA-binding
Deposited on 2011-10-11, released 2012-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-08, with a file datestamp of 2012-08-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.262
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a4da_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a4dA (A:)
    pkfeknfyqehpdlarrtaqevetyrrskeitvrghncpkpvlnfyeanfpanvmdviar
    qnfteptaiqaqgwpvalsgldmvgvaqtgsgktlsyllpaivhinhqpflergdgpicl
    vlaptrelaqqvqqvaaeycracrlkstciyggapkgpqirdlergveiciatpgrlidf
    lecgktnlrrttylvldeadrmldmgfepqirkivdqirpdrqtlmwsatwpkevrqlae
    dflkdyihiniga