PDB entry 4a3r

View 4a3r on RCSB PDB site
Description: Crystal structure of Enolase from Bacillus subtilis.
Class: lyase
Keywords: lyase, glycolysis, degradosome
Deposited on 2011-10-04, released 2012-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a3ra1, d4a3ra2
  • Chain 'B':
    Compound: enolase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a3rb1, d4a3rb2
  • Chain 'C':
    Compound: enolase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a3rc1, d4a3rc2
  • Chain 'D':
    Compound: enolase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a3rd1, d4a3rd2
  • Heterogens: CIT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a3rA (A:)
    mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
    gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
    aaadflqiplyqylggfnsktlpvpmmnivnggehadnnvdiqefmimpvgapnfrealr
    mgaqifhslksvlsakglntavgdeggfapnlgsneealqtiveaiekagfkpgeevkla
    mdaassefynkedgkyhlsgegvvktsaemvdwyeelvskypiisiedgldendweghkl
    lterlgkkvqlvgddlfvtntkklsegikngvgnsilikvnqigtltetfdaiemakrag
    ytavishrsgetedstiadiavatnagqiktgapsrtdrvakynqllriedqlaetaqyh
    ginsfynlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a3rA (A:)
    mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
    gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
    aaadflqiplyqylggfnsktlpvpmmnivnggehadnnvdiqefmimpvgapnfrealr
    mgaqifhslksvlsakglntavgdeggfapnlgsneealqtiveaiekagfkpgeevkla
    mdaassefynkedgkyhlsgegvvktsaemvdwyeelvskypiisiedgldendweghkl
    lterlgkkvqlvgddlfvtntkklsegikngvgnsilikvnqigtltetfdaiemakrag
    ytavishrsgetedstiadiavatnagqiktgapsrtdrvakynqllriedqlaetaqyh
    ginsfynl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a3rB (B:)
    mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
    gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
    aaadflqiplyqylggfnsktlpvpmmnivnggehadnnvdiqefmimpvgapnfrealr
    mgaqifhslksvlsakglntavgdeggfapnlgsneealqtiveaiekagfkpgeevkla
    mdaassefynkedgkyhlsgegvvktsaemvdwyeelvskypiisiedgldendweghkl
    lterlgkkvqlvgddlfvtntkklsegikngvgnsilikvnqigtltetfdaiemakrag
    ytavishrsgetedstiadiavatnagqiktgapsrtdrvakynqllriedqlaetaqyh
    ginsfynlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a3rB (B:)
    mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
    gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
    aaadflqiplyqylggfnsktlpvpmmnivnggehadnnvdiqefmimpvgapnfrealr
    mgaqifhslksvlsakglntavgdeggfapnlgsneealqtiveaiekagfkpgeevkla
    mdaassefynkedgkyhlsgegvvktsaemvdwyeelvskypiisiedgldendweghkl
    lterlgkkvqlvgddlfvtntkklsegikngvgnsilikvnqigtltetfdaiemakrag
    ytavishrsgetedstiadiavatnagqiktgapsrtdrvakynqllriedqlaetaqyh
    ginsfynl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a3rC (C:)
    mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
    gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
    aaadflqiplyqylggfnsktlpvpmmnivnggehadnnvdiqefmimpvgapnfrealr
    mgaqifhslksvlsakglntavgdeggfapnlgsneealqtiveaiekagfkpgeevkla
    mdaassefynkedgkyhlsgegvvktsaemvdwyeelvskypiisiedgldendweghkl
    lterlgkkvqlvgddlfvtntkklsegikngvgnsilikvnqigtltetfdaiemakrag
    ytavishrsgetedstiadiavatnagqiktgapsrtdrvakynqllriedqlaetaqyh
    ginsfynlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a3rC (C:)
    mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
    gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
    aaadflqiplyqylggfnsktlpvpmmnivnggehadnnvdiqefmimpvgapnfrealr
    mgaqifhslksvlsakglntavgdeggfapnlgsneealqtiveaiekagfkpgeevkla
    mdaassefynkedgkyhlsgegvvktsaemvdwyeelvskypiisiedgldendweghkl
    lterlgkkvqlvgddlfvtntkklsegikngvgnsilikvnqigtltetfdaiemakrag
    ytavishrsgetedstiadiavatnagqiktgapsrtdrvakynqllriedqlaetaqyh
    ginsfynl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a3rD (D:)
    mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
    gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
    aaadflqiplyqylggfnsktlpvpmmnivnggehadnnvdiqefmimpvgapnfrealr
    mgaqifhslksvlsakglntavgdeggfapnlgsneealqtiveaiekagfkpgeevkla
    mdaassefynkedgkyhlsgegvvktsaemvdwyeelvskypiisiedgldendweghkl
    lterlgkkvqlvgddlfvtntkklsegikngvgnsilikvnqigtltetfdaiemakrag
    ytavishrsgetedstiadiavatnagqiktgapsrtdrvakynqllriedqlaetaqyh
    ginsfynlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a3rD (D:)
    mpyivdvyarevldsrgnptvevevytetgafgralvpsgastgeyeavelrdgdkdryl
    gkgvltavnnvneiiapellgfdvteqnaidqllieldgtenkgklganailgvsmacar
    aaadflqiplyqylggfnsktlpvpmmnivnggehadnnvdiqefmimpvgapnfrealr
    mgaqifhslksvlsakglntavgdeggfapnlgsneealqtiveaiekagfkpgeevkla
    mdaassefynkedgkyhlsgegvvktsaemvdwyeelvskypiisiedgldendweghkl
    lterlgkkvqlvgddlfvtntkklsegikngvgnsilikvnqigtltetfdaiemakrag
    ytavishrsgetedstiadiavatnagqiktgapsrtdrvakynqllriedqlaetaqyh
    ginsfynl