PDB entry 4a2u

View 4a2u on RCSB PDB site
Description: CRP(CAP) from Myco. Tuberculosis, with cAMP
Class: transcription
Keywords: transcription, cyclic amp receptor, transcription regulation, catabolite gene activator protein, allostery, DNA-binding
Deposited on 2011-09-28, released 2012-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.18853
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable transcriptional regulatory protein (probably crp/ fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a2ua1, d4a2ua2
  • Chain 'B':
    Compound: probable transcriptional regulatory protein (probably crp/ fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a2ub1, d4a2ub2
  • Chain 'C':
    Compound: probable transcriptional regulatory protein (probably crp/ fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a2uc1, d4a2uc2
  • Chain 'D':
    Compound: probable transcriptional regulatory protein (probably crp/ fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a2ud1, d4a2ud2
  • Chain 'E':
    Compound: probable transcriptional regulatory protein (probably crp/ fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a2ue1, d4a2ue2
  • Chain 'F':
    Compound: probable transcriptional regulatory protein (probably crp/ fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69644 (3-226)
      • expression tag (1)
    Domains in SCOPe 2.07: d4a2uf1, d4a2uf2, d4a2uf3
  • Chain 'G':
    Compound: probable transcriptional regulatory protein (probably crp/ fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a2ug1, d4a2ug2
  • Chain 'H':
    Compound: probable transcriptional regulatory protein (probably crp/ fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69644 (3-226)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4a2uh1, d4a2uh2, d4a2uh3
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a2uA (A:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a2uA (A:)
    mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
    apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
    eqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeei
    aqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a2uB (B:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a2uB (B:)
    mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
    apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
    eqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeei
    aqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a2uC (C:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a2uC (C:)
    mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
    apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
    eqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeei
    aqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a2uD (D:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a2uD (D:)
    saiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrrapdgrenlltimgpsd
    mfgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqllrvlarrlrrtnn
    nladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkala
    dfahrgwirlegksvlisdserlarrar
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4a2uE (E:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a2uE (E:)
    mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
    apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
    eqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeei
    aqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4a2uF (F:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a2uF (F:)
    smdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigr
    rapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpei
    seqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqee
    iaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4a2uG (G:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a2uG (G:)
    mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
    apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
    eqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeei
    aqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a2uH (H:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar