PDB entry 4a2j

View 4a2j on RCSB PDB site
Description: PR X-Ray structures in agonist conformations reveal two different mechanisms for partial agonism in 11beta-substituted steroids
Class: transcription
Keywords: transcription, partial agonist
Deposited on 2011-09-27, released 2012-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.20631
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a2ja_
  • Chain 'B':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a2jb_
  • Heterogens: AS0, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a2jA (A:)
    gshmgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkws
    kslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkess
    fyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyireli
    kaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevi
    aaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a2jA (A:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a2jB (B:)
    gshmgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkws
    kslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkess
    fyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyireli
    kaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevi
    aaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a2jB (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfhk