PDB entry 4a25

View 4a25 on RCSB PDB site
Description: X-ray structure Dps from Kineococcus radiotolerans in complex with Mn (II) ions.
Class: metal binding protein
Keywords: metal binding protein, detoxification process
Deposited on 2011-09-22, released 2012-10-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19608
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin dps family protein
    Species: KINEOCOCCUS RADIOTOLERANS [TaxId:131568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a25a_
  • Chain 'B':
    Compound: ferritin dps family protein
    Species: KINEOCOCCUS RADIOTOLERANS [TaxId:131568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a25b_
  • Chain 'C':
    Compound: ferritin dps family protein
    Species: KINEOCOCCUS RADIOTOLERANS [TaxId:131568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a25c_
  • Chain 'D':
    Compound: ferritin dps family protein
    Species: KINEOCOCCUS RADIOTOLERANS [TaxId:131568]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4a25d_
  • Heterogens: MN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a25A (A:)
    ttihdvqttgltqdavtgfdassrlnaglqevlvdltalhlqgkqahwnivgenwrdlhl
    qldtlveaargfsddvaermravggvpdarpqtvaasrigdvgpdeidtracveaivalv
    rhtvdtirrvhdpidaedpasadllhaitlelekqawmigsenrsprrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a25A (A:)
    ttihdvqttgltqdavtgfdassrlnaglqevlvdltalhlqgkqahwnivgenwrdlhl
    qldtlveaargfsddvaermravggvpdarpqtvaasrigdvgpdeidtracveaivalv
    rhtvdtirrvhdpidaedpasadllhaitlelekqawmigsenrspr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a25B (B:)
    ttihdvqttgltqdavtgfdassrlnaglqevlvdltalhlqgkqahwnivgenwrdlhl
    qldtlveaargfsddvaermravggvpdarpqtvaasrigdvgpdeidtracveaivalv
    rhtvdtirrvhdpidaedpasadllhaitlelekqawmigsenrsprrr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4a25C (C:)
    ttihdvqttgltqdavtgfdassrlnaglqevlvdltalhlqgkqahwnivgenwrdlhl
    qldtlveaargfsddvaermravggvpdarpqtvaasrigdvgpdeidtracveaivalv
    rhtvdtirrvhdpidaedpasadllhaitlelekqawmigsenrsprrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a25D (D:)
    ttihdvqttgltqdavtgfdassrlnaglqevlvdltalhlqgkqahwnivgenwrdlhl
    qldtlveaargfsddvaermravggvpdarpqtvaasrigdvgpdeidtracveaivalv
    rhtvdtirrvhdpidaedpasadllhaitlelekqawmigsenrsprrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a25D (D:)
    tihdvqttgltqdavtgfdassrlnaglqevlvdltalhlqgkqahwnivgenwrdlhlq
    ldtlveaargfsddvaermravggvpdarpqtvaasrigdvgpdeidtracveaivalvr
    htvdtirrvhdpidaedpasadllhaitlelekqawmigsenrspr