PDB entry 4a20

View 4a20 on RCSB PDB site
Description: Crystal structure of the Ubl domain of Mdy2 (Get5) at 1.78A
Class: protein binding
Keywords: protein binding, get-pathway, tail-anchored proteins
Deposited on 2011-09-21, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.20327
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-like protein mdy2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a20a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a20A (A:)
    mahhhhhhvddddkmdnaavhltlkkiqapkfsiehdfspsdtilqikqhliseekashi
    seiklllkgkvlhdnlflsdlkvtpanstitvmikpnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a20A (A:)
    aavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlf
    lsdlkvtpanstitvmikpn