PDB entry 4a1u

View 4a1u on RCSB PDB site
Description: Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL
Class: apoptosis
Keywords: apoptosis, alpha-helix, bh3, mimicry
Deposited on 2011-09-20, released 2011-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bcl-2-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4a1ua1, d4a1ua2
  • Chain 'B':
    Compound: alpha-beta-foldamer 2c
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 4A1U
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4a1uA (A:)
gplgsmsqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsq
lhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawma
tylndhlepwiqenggwdtfvelygnnaaaesrkgqer

    Sequence, based on observed residues (ATOM records): (download) 
    >4a1uA (A:)
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaaaesrkg

  • Chain 'B':
    No sequence available.