PDB entry 4a0m

View 4a0m on RCSB PDB site
Description: crystal structure of betaine aldehyde dehydrogenase from spinach in complex with nad
Class: oxidoreductase
Keywords: aldehyde oxidation, nad complex, oxidoreductase
Deposited on 2011-09-09, released 2012-04-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2343
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a0ma_
  • Chain 'B':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a0mb_
  • Chain 'C':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a0mc_
  • Chain 'D':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4a0md_
  • Heterogens: K, NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4a0mA (A:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a0mA (A:)
    fpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnn
    wsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqa
    ealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlk
    pselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgsk
    vmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvhes
    iaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsr
    pehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaav
    fsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqv
    tqdisdepwgwyks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4a0mB (B:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a0mB (B:)
    fpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnn
    wsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqa
    ealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlk
    pselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgsk
    vmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvhes
    iaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsr
    pehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaav
    fsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqv
    tqdisdepwgwyks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4a0mC (C:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a0mC (C:)
    fpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnn
    wsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqa
    ealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlk
    pselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgsk
    vmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvhes
    iaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsr
    pehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaav
    fsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqv
    tqdisdepwgwyks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4a0mD (D:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4a0mD (D:)
    fpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnn
    wsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqa
    ealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlk
    pselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgsk
    vmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvhes
    iaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsr
    pehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaav
    fsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqv
    tqdisdepwgwyks