PDB entry 3zzn

View 3zzn on RCSB PDB site
Description: 5-Mutant (R79W, R151A, E279A, E299A,E313A) Lactate-Dehydrogenase from Thermus thermophillus
Class: oxidoreductase
Keywords: protein adaptation, conformational energy landscape, oxidoreductase, hyperthermophilic
Deposited on 2011-09-02, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.1919
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (57)
      • engineered mutation (127)
      • engineered mutation (259)
      • engineered mutation (278)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d3zzna1, d3zzna2
  • Chain 'B':
    Compound: lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (57)
      • engineered mutation (127)
      • engineered mutation (259)
      • engineered mutation (278)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d3zznb1, d3zznb2
  • Chain 'C':
    Compound: lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (57)
      • engineered mutation (127)
      • engineered mutation (259)
      • engineered mutation (278)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d3zznc1, d3zznc2
  • Chain 'D':
    Compound: lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (57)
      • engineered mutation (127)
      • engineered mutation (259)
      • engineered mutation (278)
      • engineered mutation (291)
    Domains in SCOPe 2.07: d3zznd1, d3zznd2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zznA (A:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalgf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zznB (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalgf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zznC (C:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalgf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zznD (D:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayalsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargralspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevagvlevslslprilgaggvagtvypslspeeraalrrsaei
    lkeaafalgf