PDB entry 3zzh

View 3zzh on RCSB PDB site
Description: Crystal structure of the amino acid kinase domain from Saccharomyces cerevisiae acetylglutamate kinase in complex with its feed- back inhibitor L-arginine
Class: transferase
Keywords: transferase, arginine biosynthesis
Deposited on 2011-09-01, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylglutamate kinase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zzha_
  • Chain 'B':
    Compound: acetylglutamate kinase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zzhb_
  • Chain 'C':
    Compound: acetylglutamate kinase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zzhc_
  • Chain 'D':
    Compound: acetylglutamate kinase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zzhd_
  • Heterogens: ARG, EDO, CL, MLI, NLG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zzhA (A:)
    mghhhhhhvsstngfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaii
    sdnlhelasclaflyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvr
    kcfleqnlklvtaleqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikag
    alpiltslaetasgqmlnvnadvaagelarvfeplkivylnekggiingstgekisminl
    deeyddlmkqswvkygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmir
    rgyklvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zzhA (A:)
    ngfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaiisdnlhelascla
    flyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvrkcfleqnlklvt
    aleqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikagalpiltslaeta
    sgqmlnvnadvaagelarvfeplkivylnekggiingstgekisminldeeyddlmkqsw
    vkygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmirrgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zzhB (B:)
    mghhhhhhvsstngfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaii
    sdnlhelasclaflyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvr
    kcfleqnlklvtaleqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikag
    alpiltslaetasgqmlnvnadvaagelarvfeplkivylnekggiingstgekisminl
    deeyddlmkqswvkygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmir
    rgyklvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zzhB (B:)
    gfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaiisdnlhelasclaf
    lyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvrkcfleqnlklvta
    leqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikagalpiltslaetas
    gqmlnvnadvaagelarvfeplkivylnekggiingstgekisminldeeyddlmkqswv
    kygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmirrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zzhC (C:)
    mghhhhhhvsstngfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaii
    sdnlhelasclaflyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvr
    kcfleqnlklvtaleqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikag
    alpiltslaetasgqmlnvnadvaagelarvfeplkivylnekggiingstgekisminl
    deeyddlmkqswvkygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmir
    rgyklvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zzhC (C:)
    gfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaiisdnlhelasclaf
    lyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvrkcfleqnlklvta
    leqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikagalpiltslaetas
    gqmlnvnadvaagelarvfeplkivylnekggiingstgekisminldeeyddlmkqswv
    kygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmirr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zzhD (D:)
    mghhhhhhvsstngfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaii
    sdnlhelasclaflyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvr
    kcfleqnlklvtaleqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikag
    alpiltslaetasgqmlnvnadvaagelarvfeplkivylnekggiingstgekisminl
    deeyddlmkqswvkygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmir
    rgyklvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zzhD (D:)
    gfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaiisdnlhelasclaf
    lyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvrkcfleqnlklvta
    leqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikagalpiltslaetas
    gqmlnvnadvaagelarvfeplkivylnekggiingstgekisminldeeyddlmkqswv
    kygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmirrg