PDB entry 3zw3

View 3zw3 on RCSB PDB site
Description: fragment based discovery of a novel and selective pi3 kinase inhibitor
Class: transferase
Keywords: transferase
Deposited on 2011-07-28, released 2011-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.1871
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zw3a1, d3zw3a2, d3zw3a3
  • Heterogens: ZW3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zw3A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zw3A (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakdfvlrvcgr
    deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgidip
    vlltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycl
    lyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisilldnhpiar
    aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv
    aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv
    qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc
    gtamlhdftqqvqviemlqkvtldikslsssqvisqlkqklenlqnsqlpesfrvpydpg
    lkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilri
    mesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhw
    lkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilg
    nyrvpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgm
    pqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhl