PDB entry 3zvh

View 3zvh on RCSB PDB site
Description: Methylaspartate ammonia lyase from Clostridium tetanomorphum mutant Q73A
Class: lyase
Keywords: lyase, enolase
Deposited on 2011-07-25, released 2012-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.19768
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylaspartate ammonia-lyase
    Species: Clostridium tetanomorphum [TaxId:1553]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05514 (0-412)
      • expression tag (413-414)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d3zvha1, d3zvha2, d3zvha3
  • Chain 'B':
    Compound: methylaspartate ammonia-lyase
    Species: Clostridium tetanomorphum [TaxId:1553]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05514 (0-412)
      • expression tag (413-414)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d3zvhb1, d3zvhb2, d3zvhb3
  • Heterogens: MG, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zvhA (A:)
    mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
    dgqvahgdcaavaysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
    vngnrlhtairygitqaildavaktrkvtmaevirdeynpgaeinavpvfaqsgddrydn
    vdkmiikeadvlphalinnveeklglkgeklleyvkwlrdriiklrvredyapifhidvy
    gtigaafdvdikamadyiqtlaeaakpfhlriegpmdvedrqkqmeamrdlraeldgrgv
    daelvadewcntvedvkfftdnkaghmvqiktpdlggvnniadaimyckangmgaycggt
    cnetnrsaevttnigmacgarqvlakpgmgvdegmmivknemnrvlalvgrrkklgpeqk
    liseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zvhA (A:)
    mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
    dgqvahgdcaavaysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
    vngnrlhtairygitqaildavaktrkvtmaevirdeynpgaeinavpvfaqsgddrydn
    vdkmiikeadvlphalinnveeklglkgeklleyvkwlrdriiklrvredyapifhidvy
    gtigaafdvdikamadyiqtlaeaakpfhlriegpmdvedrqkqmeamrdlraeldgrgv
    daelvadewcntvedvkfftdnkaghmvqiktpdlggvnniadaimyckangmgaycggt
    cnetnrsaevttnigmacgarqvlakpgmgvdegmmivknemnrvlalvgrrkkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zvhB (B:)
    mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
    dgqvahgdcaavaysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
    vngnrlhtairygitqaildavaktrkvtmaevirdeynpgaeinavpvfaqsgddrydn
    vdkmiikeadvlphalinnveeklglkgeklleyvkwlrdriiklrvredyapifhidvy
    gtigaafdvdikamadyiqtlaeaakpfhlriegpmdvedrqkqmeamrdlraeldgrgv
    daelvadewcntvedvkfftdnkaghmvqiktpdlggvnniadaimyckangmgaycggt
    cnetnrsaevttnigmacgarqvlakpgmgvdegmmivknemnrvlalvgrrkklgpeqk
    liseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zvhB (B:)
    mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
    dgqvahgdcaavaysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
    vngnrlhtairygitqaildavaktrkvtmaevirdeynpgaeinavpvfaqsgddrydn
    vdkmiikeadvlphalinnveeklglkgeklleyvkwlrdriiklrvredyapifhidvy
    gtigaafdvdikamadyiqtlaeaakpfhlriegpmdvedrqkqmeamrdlraeldgrgv
    daelvadewcntvedvkfftdnkaghmvqiktpdlggvnniadaimyckangmgaycggt
    cnetnrsaevttnigmacgarqvlakpgmgvdegmmivknemnrvlalvgrrkkl