PDB entry 3zuk

View 3zuk on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis zinc metalloprotease zmp1 in complex with inhibitor
Class: hydrolase/inhibitor
Keywords: hydrolase-inhibitor complex, pathogenicity, phagosome maturation
Deposited on 2011-07-19, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.17661
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endopeptidase, peptidase family m13
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zuka_
  • Chain 'B':
    Compound: endopeptidase, peptidase family m13
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zukb_
  • Heterogens: ZN, RDF, 211, PEG, PGE, PG4, ACT, SO4, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zukA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdhpftmtlaipsgidlshidadarpqddl
    fghvngrwlaeheipadratdgafrslfdraetqvrdliiqasqagaavgtdaqrigdly
    asfldeeaveragvqplhdelatidsaadatelaaalgtlqragvgggigvyvdtdskds
    trylvhftqsgiglpdesyyrdeqhaavlaaypghiarmfglvyggesrdhaktadriva
    letkladahwdvvkrrdadlgynlrtfaqlqtegagfdwvswvtalgsapdamtelvvrq
    pdylvtfaslwasvnvedwkcwarwrlirarapwltralvaedfefygrtltgaqqlrdr
    wkrgvslvenlmgdavgklyvqrhfppdaksridtlvdnlqeayrisiseldwmtpqtrq
    ralaklnkftakvgypikwrdysklaidrddlygnvqrgyavnhdrelaklfgpvdrdew
    fmtpqtvnayynpgmneivfpaailqppffdpqadeaanyggigavigheighgfddqga
    kydgdgnlvdwwtdddrtefaartkalieqyhaytprdlvdhpgpphvqgaftigenigd
    lgglsiallayqlslngnpapvidgltgmqrvffgwaqiwrtksraaeairrlavdphsp
    pefrcngvvrnvdafyqafdvteddalfldpqrrvriwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zukA (A:)
    aipsgidlshidadarpqddlfghvngrwlaeheipadratdgafrslfdraetqvrdli
    iqasqagaavgtdaqrigdlyasfldeeaveragvqplhdelatidsaadatelaaalgt
    lqragvgggigvyvdtdskdstrylvhftqsgiglpdesyyrdeqhaavlaaypghiarm
    fglvyggesrdhaktadrivaletkladahwdvvkrrdadlgynlrtfaqlqtegagfdw
    vswvtalgsapdamtelvvrqpdylvtfaslwasvnvedwkcwarwrlirarapwltral
    vaedfefygrtltgaqqlrdrwkrgvslvenlmgdavgklyvqrhfaksridtlvdnlqe
    ayrisiseldwmtpqtrqralaklnkftakvgypikwrdysklaidrddlygnvqrgyav
    nhdrelaklfgpvdrdewfmtpqtvnayynpgmneivfpaailqppffdpqadeaanygg
    igavigheighgfddqgakydgdgnlvdwwtdddrtefaartkalieqyhaytprdlvdh
    pgpphvqgaftigenigdlgglsiallayqlslngnpapvidgltgmqrvffgwaqiwrt
    ksraaeairrlavdphsppefrcngvvrnvdafyqafdvteddalfldpqrrvriwn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zukB (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdhpftmtlaipsgidlshidadarpqddl
    fghvngrwlaeheipadratdgafrslfdraetqvrdliiqasqagaavgtdaqrigdly
    asfldeeaveragvqplhdelatidsaadatelaaalgtlqragvgggigvyvdtdskds
    trylvhftqsgiglpdesyyrdeqhaavlaaypghiarmfglvyggesrdhaktadriva
    letkladahwdvvkrrdadlgynlrtfaqlqtegagfdwvswvtalgsapdamtelvvrq
    pdylvtfaslwasvnvedwkcwarwrlirarapwltralvaedfefygrtltgaqqlrdr
    wkrgvslvenlmgdavgklyvqrhfppdaksridtlvdnlqeayrisiseldwmtpqtrq
    ralaklnkftakvgypikwrdysklaidrddlygnvqrgyavnhdrelaklfgpvdrdew
    fmtpqtvnayynpgmneivfpaailqppffdpqadeaanyggigavigheighgfddqga
    kydgdgnlvdwwtdddrtefaartkalieqyhaytprdlvdhpgpphvqgaftigenigd
    lgglsiallayqlslngnpapvidgltgmqrvffgwaqiwrtksraaeairrlavdphsp
    pefrcngvvrnvdafyqafdvteddalfldpqrrvriwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zukB (B:)
    aipsgidlshidadarpqddlfghvngrwlaeheipadratdgafrslfdraetqvrdli
    iqasqagaavgtdaqrigdlyasfldeeaveragvqplhdelatidsaadatelaaalgt
    lqragvgggigvyvdtdskdstrylvhftqsgiglpdesyyrdeqhaavlaaypghiarm
    fglvyggesrdhaktadrivaletkladahwdvvkrrdadlgynlrtfaqlqtegagfdw
    vswvtalgsapdamtelvvrqpdylvtfaslwasvnvedwkcwarwrlirarapwltral
    vaedfefygrtltgaqqlrdrwkrgvslvenlmgdavgklyvqrhfaksridtlvdnlqe
    ayrisiseldwmtpqtrqralaklnkftakvgypikwrdysklaidrddlygnvqrgyav
    nhdrelaklfgpvdrdewfmtpqtvnayynpgmneivfpaailqppffdpqadeaanygg
    igavigheighgfddqgakydgdgnlvdwwtdddrtefaartkalieqyhaytprdlvdh
    pgpphvqgaftigenigdlgglsiallayqlslngnpapvidgltgmqrvffgwaqiwrt
    ksraaeairrlavdphsppefrcngvvrnvdafyqafdvteddalfldpqrrvriwn