PDB entry 3ztx

View 3ztx on RCSB PDB site
Description: Aurora kinase selective inhibitors identified using a Taxol-induced checkpoint sensitivity screen.
Class: transferase/cell cycle
Keywords: transferase-cell cycle complex, transferase, taxol-induced checkpoint inhibitor
Deposited on 2011-07-12, released 2012-02-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.18775
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 12-a
    Species: XENOPUS LAEVIS [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ztxa_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 12-a
    Species: XENOPUS LAEVIS [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ztxb_
  • Chain 'C':
    Compound: inner centromere protein a
    Species: XENOPUS LAEVIS [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: inner centromere protein a
    Species: XENOPUS LAEVIS [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ztxA (A:)
    talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
    lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
    eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
    pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
    dliskllryhppqrlplkgvmehpwvkansrrvlppvyqstqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ztxA (A:)
    kftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqs
    hlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhy
    cherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkth
    dekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllry
    hppqrlplkgvmehpwvkansrrvlppvyq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ztxB (B:)
    talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
    lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
    eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
    pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
    dliskllryhppqrlplkgvmehpwvkansrrvlppvyqstqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ztxB (B:)
    talaempkrkftiddfdigrplgnvylarekqnkfimalkvlfksqlekegvehqlrrei
    eiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeelad
    alhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemie
    gkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdlisk
    llryhppqrlplkgvmehpwvkansrrvlppvy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.