PDB entry 3zrl

View 3zrl on RCSB PDB site
Description: Identification of 2-(4-pyridyl)thienopyridinones as GSK-3beta inhibitors
Class: transferase/peptide
Keywords: transferase-peptide complex, kinase
Deposited on 2011-06-17, released 2011-06-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.18789
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3zrla_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3zrlb_
  • Chain 'X':
    Compound: proto-oncogene frat1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: proto-oncogene frat1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, ZRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zrlA (A:)
    fgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelv
    aikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrv
    arhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfg
    sakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsg
    vdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlle
    ytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippha
    riqaaastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zrlA (A:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffysskkdevylnlvldyvpetvyrvarhysrakqtlpviy
    vklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyi
    csryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtpt
    reqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacah
    sffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zrlB (B:)
    fgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelv
    aikkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrv
    arhysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfg
    sakqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsg
    vdqlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlle
    ytptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippha
    riqaaastptn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zrlB (B:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
    iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
    yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
    ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
    ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.