PDB entry 3zrb

View 3zrb on RCSB PDB site
Description: structural basis for agonism and antagonism for a set of chemically related progesterone receptor modulators
Class: receptor
Keywords: receptor, agonist, antagonist
Deposited on 2011-06-15, released 2011-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1843
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zrba_
  • Chain 'B':
    Compound: progesterone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zrbb_
  • Heterogens: OR8, SO4, GOL, ORC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zrbA (A:)
    gshmgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkws
    kslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkess
    fyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyireli
    kaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevi
    aaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zrbA (A:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zrbB (B:)
    gshmgqdiqlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkws
    kslpgfrnlhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkess
    fyslcltmwqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyireli
    kaiglrqkgvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmsevi
    aaqlpkilagmvkpllfhkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zrbB (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfhk