PDB entry 3zqx

View 3zqx on RCSB PDB site
Description: Carbohydrate-binding module CBM3b from the cellulosomal cellobiohydrolase 9A from Clostridium thermocellum
Class: hydrolase
Keywords: hydrolase, cellulose binding protein
Deposited on 2011-06-12, released 2012-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.167
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59325 (1-145)
      • expression tag (0)
      • engineered mutation (105)
    Domains in SCOPe 2.08: d3zqxa1, d3zqxa2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3zqxA (A:)
mdvkvqylcentqtstqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytp
igsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadwsfhdqsndysfdpt
ikafqdygkvtlykngelvwgtppgg